PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla010750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family FAR1
Protein Properties Length: 257aa    MW: 29683.3 Da    PI: 6.7269
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla010750genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR192.55.4e-2993180291
       FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                fYn+YA++vGF +r+sk ++s+r+g+ + r +vC+keg+r ++k++  k  r+raetr+gC+a++ v+k ++gkw+vtk+++eH+H+l+p
  Cla010750  93 FYNSYATRVGFVIRVSKLSRSRRDGTAIGRALVCNKEGYRMPDKRE--KIVRQRAETRVGCRAMILVRKVNSGKWVVTKFVKEHTHPLSP 180
                ******************************************9988..9**************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.5E-2693180IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MRIEWNELEF GVDGDSEVVG NSTLVEDSKP LDENETGVSS IERIFDQDRD EKIIQDTSGR  60
NAILDSVPGL PVVQVDEPYV GQEFENEAAA HAFYNSYATR VGFVIRVSKL SRSRRDGTAI  120
GRALVCNKEG YRMPDKREKI VRQRAETRVG CRAMILVRKV NSGKWVVTKF VKEHTHPLSP  180
GKGRRDCIYD QYPNEHDKIR ELSQQLAIEK KRSATYKRHL EVIFEYIEEH NDNLSRKIQH  240
IVDNVKEMES IEQQNHR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818740.0LN681874.1 Cucumis melo genomic scaffold, anchoredscaffold00031.
GenBankLN7132610.0LN713261.1 Cucumis melo genomic chromosome, chr_7.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453933.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 6
TrEMBLA0A0A0KZ370.0A0A0A0KZ37_CUCSA; Uncharacterized protein
STRINGGLYMA15G03440.11e-137(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24533072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-110FAR1 family protein